HORDB

ID: hor002411
Uniprot ID: Q9GKY5
Protein name: Ghrelin
Gene name: GHRL
Organism: Sus scrofa (Pig)
Family: Motilin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0016608 growth hormone-releasing hormone activity; GO:0030296 protein tyrosine kinase activator activity; GO:0031768 ghrelin receptor binding
GO BP: GO:0001696 gastric acid secretion; GO:0001937 negative regulation of endothelial cell proliferation; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0008154 actin polymerization or depolymerization; GO:0009725 response to hormone; GO:0016358 dendrite development; GO:0032024 positive regulation of insulin secretion; GO:0032095 regulation of response to food; GO:0032097 positive regulation of response to food; GO:0032691 negative regulation of interleukin-1 beta production
GO CC: NA

Sequence: GSSFLSPEHQKVQQRKESKKPAAKLKPR
Length: 28
Propeptide: MPSTGTICSLLLLSVLLMADLAMAGSSFLSPEHQKVQQRKESKKPAAKLKPRALEGWLGPEDSGEVEGTEDKLEIRFNAPCDVGIKLSGAQSDQHGQPLGKFLQDILWEEVTEAPADK
Signal peptide: MPSTGTICSLLLLSVLLMADLAMA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation
Mechanism: NA
Cross BBB: NA
Target: GHSR
Target Unid: Q95254
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002411_AF2.pdb

hor002411_ESM.pdb

Mass:	367245	Formula:	C140H237N45O40
Absent amino acids:	CDIMNTWY	Common amino acids:	K
pI:	11.42	Basic residues:	9
Polar residues:	5	Hydrophobic residues:	6
Hydrophobicity:	-154.64	Boman Index:	-9022
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	45.36
Instability Index:	3918.93	Extinction Coefficient cystines:	0
Absorbance 280nm:	0